PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016493750.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB_related
Protein Properties Length: 205aa    MW: 23519.8 Da    PI: 9.9728
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016493750.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding431e-135498347
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +WT++E+ l++++ + +G+ +W++I++ +  +Rt  q+ s+ qky
   XP_016493750.1 54 PWTEDEHRLFLKGLEIYGKSNWAKISKDLLPNRTHIQIASHAQKY 98
                     7***************************999*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.50847103IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-114999IPR009057Homeodomain-like
TIGRFAMsTIGR015575.4E-1450101IPR006447Myb domain, plants
SuperFamilySSF466891.15E-1450102IPR009057Homeodomain-like
SMARTSM007175.4E-951101IPR001005SANT/Myb domain
CDDcd001676.19E-105499No hitNo description
PfamPF002492.8E-115498IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 205 aa     Download sequence    Send to blast
MAWNCRLCGR SGRNQRTCSE KGKSIKLFGV KISTTTPKKD SANNYGRKIK KAIPWTEDEH  60
RLFLKGLEIY GKSNWAKISK DLLPNRTHIQ IASHAQKYFM FKRLAAASNE RKNRKKPSIF  120
DVHSEEIIIS ERETSNVSEH AIQEHVQETG GNIPSQVPLE IIKEHAQDHQ ETTAISSERN  180
HGYNFFIIPC FMPVLNLPVF HSFCN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009792995.11e-154PREDICTED: uncharacterized protein LOC104239942
RefseqXP_016493750.11e-154PREDICTED: uncharacterized protein LOC107813057
TrEMBLK4D8N71e-44K4D8N7_SOLLC; Uncharacterized protein
STRINGSolyc11g050730.1.13e-44(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA74541230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G70000.25e-21MYB_related family protein